PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027861m
Common NameCARUB_v10027861mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 372aa    MW: 41529.8 Da    PI: 5.2947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027861mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl
  Carubv10027861m 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding482.8e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  Carubv10027861m  67 RGEFSSEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.579961IPR017930Myb domain
SuperFamilySSF466892.42E-2811108IPR009057Homeodomain-like
SMARTSM007173.6E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001679.94E-111661No hitNo description
PROSITE profilePS5129424.19662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2565117IPR009057Homeodomain-like
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1367112IPR001005SANT/Myb domain
CDDcd001672.73E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEQG  120
IDPVTHKPLA SNSNPTVHES SNSLDASSSD KQYSRSSSMP SLSRPPPSGS NMVSEVTEIS  180
SNDGAPVQGG TLSCKKHFKK SSSTSRLLNK VAAKATSIKD ILSASVEGSL SPTTILHASV  240
FNGFSEQIRS EEDSSNASLM NTLAEFDPFS QSSLYPEDEI NATSDLNMDQ DYDFSYFFEK  300
LGGDNNNEEN NMNVEFNHDL LMSDVSQEVS STSVDDQDNM VGNFEGWSNY LLDHTNFMYD  360
TDSDSLEKHF I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121165108B-MYB
1mse_C5e-25121162105C-Myb DNA-Binding Domain
1msf_C5e-25121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759980.0AF175998.1 Arabidopsis thaliana putative transcription factor (MYB28) mRNA, complete cds.
GenBankAY5196430.0AY519643.1 Arabidopsis thaliana MYB transcription factor (At5g61420) mRNA, complete cds.
GenBankBT0289590.0BT028959.1 Arabidopsis thaliana At5g61420 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281711.10.0hypothetical protein CARUB_v10027861mg
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLR0GD410.0R0GD41_9BRAS; Uncharacterized protein
STRINGAT5G61420.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28